PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009607346.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 565aa    MW: 62807.3 Da    PI: 7.3004
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009607346.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.81.9e-1665111148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEd+ l +av+ + g++Wk+Ia+ ++  R++ qc +rwqk+l
   XP_009607346.1  65 KGGWTPEEDDTLRRAVAVYRGKCWKKIAEFFP-DRSEVQCLHRWQKVL 111
                      688*****************************.************986 PP

2Myb_DNA-binding591e-18117163148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd++++++v ++G+  W+ Ia+ ++ gR +kqc++rw+++l
   XP_009607346.1 117 KGPWTQEEDDKIIELVVRYGPTKWSVIAKSLP-GRIGKQCRERWHNHL 163
                      79******************************.*************97 PP

3Myb_DNA-binding55.71.1e-17169212146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++WT eE++ l+da++ +G++ W+ Ia+ ++ gRt++ +k++w++
   XP_009607346.1 169 KDAWTLEEELALLDAHRIYGNK-WAEIAKVLP-GRTDNAIKNHWNS 212
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.38160111IPR017930Myb domain
SuperFamilySSF466892.87E-1561118IPR009057Homeodomain-like
SMARTSM007174.1E-1564113IPR001005SANT/Myb domain
PfamPF002491.9E-1565111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-2267119IPR009057Homeodomain-like
CDDcd001675.55E-1368111No hitNo description
PROSITE profilePS5129431.313112167IPR017930Myb domain
SuperFamilySSF466892.81E-31114210IPR009057Homeodomain-like
SMARTSM007172.2E-17116165IPR001005SANT/Myb domain
PfamPF002495.7E-18117163IPR001005SANT/Myb domain
CDDcd001671.03E-14119163No hitNo description
Gene3DG3DSA:1.10.10.605.4E-27120166IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.3E-23167218IPR009057Homeodomain-like
PROSITE profilePS5129422.569168218IPR017930Myb domain
SMARTSM007174.7E-17168216IPR001005SANT/Myb domain
PfamPF002491.9E-15169212IPR001005SANT/Myb domain
CDDcd001671.07E-12171211No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 565 aa     Download sequence    Send to blast
MNLNISMDEL KIEDCCTENK QSTAASASSV SENSGSVTVK SLEVCSPTPT SPAHRRTTGP  60
IRRAKGGWTP EEDDTLRRAV AVYRGKCWKK IAEFFPDRSE VQCLHRWQKV LNPDLVKGPW  120
TQEEDDKIIE LVVRYGPTKW SVIAKSLPGR IGKQCRERWH NHLNPNIKKD AWTLEEELAL  180
LDAHRIYGNK WAEIAKVLPG RTDNAIKNHW NSSMKKKLDF YLATGNLPSV GRDGLQNGCK  240
DTTGTASAEK ALVCSHKGSD STELASSGTT DVCKIENCDK NHQDAKLLVV NIDASNSGPK  300
NESADSEVVR WEAESPVMDS IHVKQIKEIK FEGYGKNSEV DQFKVIETPF SCEIPTCGTL  360
YYEPPQLESC ISMDSDHLNI RWAHCESDSS PSLSPSSFLT PPSSLKGSSL YSQTPESILK  420
IAARSFPNTP SIFRKRKLNS TPGNKIGNAD GDTHKDEVHD ACEDKQTDSS ENKQTDSSEK  480
YVMIRSSSKN PSYNGIGPCD TEAFNASPPY RVRSKRKSIF RSVEKQLKFA FDNEQHNTST  540
GINDSTVKEI SHVADCLRAT RMGIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-68642185159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-68642185159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009607346.10.0PREDICTED: uncharacterized protein LOC104101571 isoform X1
TrEMBLM1AHL20.0M1AHL2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000230120.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54612437
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-138myb domain protein 3r-5